Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Chromogranin-A (CHGA), partial

This Recombinant Human Chromogranin-A (CHGA), partial spans the amino acid sequence from region 19-197aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Pituitary secretory protein I

UniProt

P10645

Expression Region

19-197aa

Tag

C-terminal 10xHis-tagged

Source

Mammalian cell

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

21.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

LPVNSPMNKGDTEVMKCIVEVISDTLSKPSPMPVSQECFETLRGDERILSILRHQNLLKELQDLALQGAKERAHQQKKHSGFEDELSEVLENQSSQAELKEAVEEPSSKDVMEKREDSKEAEKSGEATDGARPQALPEPMQESKAEGNNQAPGEEEEEEEEATNTHPPASLPSQKYPGP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Carm1 (NM_153141) Mouse Tagged ORF Clone
MR209145 10 µg

Carm1 (NM_153141) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Itgb3 siRNA Oligos set (Rat)
25172176 3x 5 nmol

Itgb3 siRNA Oligos set (Rat)

Sign In for Pricing
View Details
SFRP1 (Secreted Apoptosis-related Protein 2, SARP-2, Secreted Frizzled-related Protein 1, sFRP-1, FRP-1, SARP2, FRP1, FRP)
S1012-86G 100 µg

SFRP1 (Secreted Apoptosis-related Protein 2, SARP-2, Secreted Frizzled-related Protein 1, sFRP-1, FRP-1, SARP2, FRP1, FRP)

Sign In for Pricing
View Details
Demethoxydeacetoxypseudolaric acid B analog 10mg
A18986-10 10 mg

Demethoxydeacetoxypseudolaric acid B analog 10mg

Sign In for Pricing
View Details
Human ANKRD52 Knockout A549 cell line
GTR15419201 1 Vial

Human ANKRD52 Knockout A549 cell line

Sign In for Pricing
View Details
SARS-CoV-2 (2019-nCoV) Spike S1 Mouse mAb Antibody
orb3016891 100 µL

SARS-CoV-2 (2019-nCoV) Spike S1 Mouse mAb Antibody

Sign In for Pricing
View Details