Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Insulin-like growth factor 2 (IGF2), partial

This Recombinant Human Insulin-like growth factor 2 (IGF2), partial spans the amino acid sequence from region 25-91aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Insulin-like growth factor II; Somatomedin-A; T3M-11-derived growth factor

UniProt

P01344

Expression Region

25-91aa

Tag

N-terminal hFc-tagged

Source

Mammalian cell

Origin

Homo sapiens (Human)

Field of Research

Metabolism Research; Stem Cell & Developmental Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

34.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

AYRPSETLCGGELVDTLQFVCGDRGFYFSRPASRVSRRSRGIVEECCFRSCDLALLETYCATPAKSE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Oxysophocarpine
461773-01 10 mg

Oxysophocarpine

Sign In for Pricing
View Details
Oxysophocarpine
461773-02 100 mg

Oxysophocarpine

Sign In for Pricing
View Details
Recombinant Rat Alpha-1A adrenergic receptor (Adra1a)
orb2901882-01 20 µg

Recombinant Rat Alpha-1A adrenergic receptor (Adra1a)

Sign In for Pricing
View Details
Recombinant Rat Alpha-1A adrenergic receptor (Adra1a)
orb2901882-02 100 µg

Recombinant Rat Alpha-1A adrenergic receptor (Adra1a)

Sign In for Pricing
View Details
OVOL1 Rabbit Polyclonal Antibody
orb256738-01 30 µL

OVOL1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
OVOL1 Rabbit Polyclonal Antibody
orb256738-02 50 μL

OVOL1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details