Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Insulin-like growth factor 2 (IGF2), partial

This Recombinant Human Insulin-like growth factor 2 (IGF2), partial spans the amino acid sequence from region 25-91aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Insulin-like growth factor II; Somatomedin-A; T3M-11-derived growth factor

UniProt

P01344

Expression Region

25-91aa

Tag

N-terminal hFc-tagged

Source

Mammalian cell

Origin

Homo sapiens (Human)

Field of Research

Metabolism Research; Stem Cell & Developmental Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

34.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

AYRPSETLCGGELVDTLQFVCGDRGFYFSRPASRVSRRSRGIVEECCFRSCDLALLETYCATPAKSE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GPC6 Polyclonal Antibody, FITC Conjugated
A55876-100 100 µL

GPC6 Polyclonal Antibody, FITC Conjugated

Sign In for Pricing
View Details
Human/Rat DYRK2 MAb (Clone 599542)
MAB5408-SP 25 µg

Human/Rat DYRK2 MAb (Clone 599542)

Sign In for Pricing
View Details
PHYHD1 (NM_174933) Human Tagged ORF Clone Lentiviral Particle
RC203656L2V 200 µL

PHYHD1 (NM_174933) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
ACP2 Rabbit Polyclonal Antibody (APC)
orb2580684 100 µg

ACP2 Rabbit Polyclonal Antibody (APC)

Sign In for Pricing
View Details
PDS5B
526838-01 100 µL

PDS5B

Sign In for Pricing
View Details
PDS5B
526838-02 200 µL

PDS5B

Sign In for Pricing
View Details