Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Interleukin-3 receptor subunit alpha (IL3RA), partial

This Recombinant Human Interleukin-3 receptor subunit alpha (IL3RA), partial spans the amino acid sequence from region 19-305aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

IL-3 receptor subunit alpha; IL-3R subunit alpha; IL-3R-alpha; IL-3RA; CD123; IL3RA; IL3R

UniProt

P26951

Expression Region

19-305aa

Tag

C-terminal hFc1-tagged

Source

Mammalian cell

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

60.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

TKEDPNPPITNLRMKAKAQQLTWDLNRNVTDIECVKDADYSMPAVNNSYCQFGAISLCEVTNYTVRVANPPFSTWILFPENSGKPWAGAENLTCWIHDVDFLSCSWAVGPGAPADVQYDLYLNVANRRQQYECLHYKTDAQGTRIGCRFDDISRLSSGSQSSHILVRGRSAAFGIPCTDKFVVFSQIEILTPPNMTAKCNKTHSFMHWKMRSHFNRKFRYELQIQKRMQPVITEQVRDRTSFQLLNPGTYTVQIRARERVYEFLSAWSTPQRFECDQEEGANTRAWR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD34 (QBEnd/10), CF660R conjugate, 0.1mg/mL
BNC610640-500 1x 500 µL

CD34 (QBEnd/10), CF660R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ELISA Kit For UBA-like domain-containing protein 1
E16160h 96 Tests

ELISA Kit For UBA-like domain-containing protein 1

Sign In for Pricing
View Details
GTF3C2 (KIAA0011, General Transcription Factor 3C Polypeptide 2, TF3C-beta, Transcription Factor IIIC 110kD Subunit, Transcription Factor IIIC Subunit beta) (HRP)
MBS6152807-01 0.1 mL

GTF3C2 (KIAA0011, General Transcription Factor 3C Polypeptide 2, TF3C-beta, Transcription Factor IIIC 110kD Subunit, Transcription Factor IIIC Subunit beta) (HRP)

Sign In for Pricing
View Details
GTF3C2 (KIAA0011, General Transcription Factor 3C Polypeptide 2, TF3C-beta, Transcription Factor IIIC 110kD Subunit, Transcription Factor IIIC Subunit beta) (HRP)
MBS6152807-02 5x 0.1 mL

GTF3C2 (KIAA0011, General Transcription Factor 3C Polypeptide 2, TF3C-beta, Transcription Factor IIIC 110kD Subunit, Transcription Factor IIIC Subunit beta) (HRP)

Sign In for Pricing
View Details
Recombinant Brucella ovis Acetyl-coenzyme A carboxylase carboxyl transferase subunit alpha (accA)
MBS1236793-01 0.02 mg (E-Coli)

Recombinant Brucella ovis Acetyl-coenzyme A carboxylase carboxyl transferase subunit alpha (accA)

Sign In for Pricing
View Details
Recombinant Brucella ovis Acetyl-coenzyme A carboxylase carboxyl transferase subunit alpha (accA)
MBS1236793-02 0.02 mg (Yeast)

Recombinant Brucella ovis Acetyl-coenzyme A carboxylase carboxyl transferase subunit alpha (accA)

Sign In for Pricing
View Details