Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Macaca mulatta Interleukin-6 receptor subunit alpha (IL6R), partial (Active)

This Recombinant Macaca fascicularis interleukin-6 receptor subunit alpha (IL6R), partial spans the amino acid sequence from region 20-365aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Interleukin-6 receptor subunit alpha; IL-6R 1

UniProt

A0A5F8AUE5

Expression Region

20-365aa

Tag

C-terminal 10xHis-tagged

Source

Mammalian cell

Origin

Macaca mulatta (Rhesus macaque)

Field of Research

Immunology & Inflammation

Purity

Greater than 95% as determined by SDS-PAGE. Greater than 90% as determined by SEC-HPLC.

Bioactivity

1Measured by its binding ability in a functional ELISA. Immobilized Macaca fascicularis IL6R at 2 μg/mL can bind Anti-IL6R recombinant antibody. The EC50 is 26.59-31.72 ng/mL. 2IL6R Recombinant Monoclonal Antibody captured on Protein A Chip can bind Recombinant Macaca fascicularis IL6R with an affinity constant of 0.381 nM as detected by MetaSPR Assay.

Form

Lyophilized powder

Molecular Weight

39.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

LAPGGCPAQEVARGVLTSLPGDSVTLTCPGGEPEDNATVHWVLRKPAVGSHLSRWAGVGRRLLLRSVQLHDSGNYSCYRAGRPAGTVHLLVDVPPEEPQLSCFRKSPLSNVVCEWGPRSTPSPTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCVASSVGSKLSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSPEAMGTPWTESRSPPAENEVSTPTQAPTTNKDDDNILSRDSANATSLPVQDSSSVPLP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal INTS11 Antibody
NBP1-85474-25ul 25 µL

Rabbit Polyclonal INTS11 Antibody

Sign In for Pricing
View Details
PEX11B Recombinant Rabbit mAb
BS45279-01 50 µL

PEX11B Recombinant Rabbit mAb

Sign In for Pricing
View Details
PEX11B Recombinant Rabbit mAb
BS45279-02 100 µL

PEX11B Recombinant Rabbit mAb

Sign In for Pricing
View Details
Follistatin-related protein 4 Antibody (Fluoro647)
orb3166184 100 µg

Follistatin-related protein 4 Antibody (Fluoro647)

Sign In for Pricing
View Details
Chicken Lp-PL-A2 ELISA Kit
ECKL0212 96 Tests

Chicken Lp-PL-A2 ELISA Kit

Sign In for Pricing
View Details
CHRM2 Rabbit Monoclonal Antibody [Clone ID: R01-9B9]
TA383998 100 µL

CHRM2 Rabbit Monoclonal Antibody [Clone ID: R01-9B9]

Sign In for Pricing
View Details