Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Granulocyte colony-stimulating factor (CSF3)

This Recombinant Human Granulocyte colony-stimulating factor (CSF3) spans the amino acid sequence from region 31-204aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Pluripoietin

UniProt

P09919

Expression Region

31-204aa

Tag

N-terminal hFc1-tagged

Source

Mammalian cell

Origin

Homo sapiens (Human)

Field of Research

Cancer Biology

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

44.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

TPLGPASSLPQSFLLKCLEQVRKIQGDGAALQEKLCATYKLCHPEELVLLGHSLGIPWAPLSSCPSQALQLAGCLSQLHSGLFLYQGLLQALEGISPELGPTLDTLQLDVADFATTIWQQMEELGMAPALQPTQGAMPAFASAFQRRAGGVLVASHLQSFLEVSYRVLRHLAQP

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

DMC1 (DMC1 dosage Suppressor of mck1 Homolog, meiosis-Specific Homologous recombination (yeast), DMC1H, HsLim15, LIM15, MGC150472, MGC150473, dJ199H16.1) (PE)
245414-PE 100 µL

DMC1 (DMC1 dosage Suppressor of mck1 Homolog, meiosis-Specific Homologous recombination (yeast), DMC1H, HsLim15, LIM15, MGC150472, MGC150473, dJ199H16.1) (PE)

Sign In for Pricing
View Details
TBKBP1 Antibody (Biotin)
orb686159-01 50 μL

TBKBP1 Antibody (Biotin)

Sign In for Pricing
View Details
TBKBP1 Antibody (Biotin)
orb686159-02 100 µL

TBKBP1 Antibody (Biotin)

Sign In for Pricing
View Details
RPA70 Recombinant Antibody, AbBy Fluor™ 750 Conjugated
bsm-61698R-BF750-01 20 µL

RPA70 Recombinant Antibody, AbBy Fluor™ 750 Conjugated

Sign In for Pricing
View Details
RPA70 Recombinant Antibody, AbBy Fluor™ 750 Conjugated
bsm-61698R-BF750-02 100 µL

RPA70 Recombinant Antibody, AbBy Fluor™ 750 Conjugated

Sign In for Pricing
View Details
Rat HIF1a (Hypoxia Inducible Factor 1 Alpha) ELISA Kit
EK241117 96 Well

Rat HIF1a (Hypoxia Inducible Factor 1 Alpha) ELISA Kit

Sign In for Pricing
View Details