Recombinant Macaca fascicularis Macaca fascicularis brain cDNA clone: QorA-11660, similar to human lymphocyte antigen 6 complex, locus E (LY6E), mRNA, RefSeq: NM_002346.1
Selected Variant
GTR19122448-01
Size: 20 µg
This Recombinant Macaca fascicularis Macaca fascicularis brain cDNA clone: QorA-11660, similar to human lymphocyte antigen 6 complex, locus E (LY6E), mRNA, RefSeq: NM_002346.1 spans the amino acid sequence from region 21-131aa. Purity: Greater than 95% as determined by SDS-PAGE.
Product Specifications
UniProt
I7G3A4
Expression Region
21-131aa
Tag
C-terminal hFc1-tagged
Source
Mammalian cell
Origin
Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)
Field of Research
Neuroscience; Immunology & Inflammation; Molecular Biology
Purity
Greater than 95% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Molecular Weight
40.3 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
AA Sequence
LMCFSCLNQKSNLYCLKPTICSDQDNYCVTVSTSAGIGNLVTFGHSLSKTCSPACPLPEGINVGVASMGISCCQSFLCNFSAADGGLRASATLLGAGLLLSLLPALLRFGP
Available Sizes
Price
Sign In for Pricing
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC680859-100 1x 100 µL
Human Kappa Light Chain (Kap-56), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC470862-500 1x 500 µL
Glypican-3 (1G12), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details ![ASC1 Recombinant Rabbit Monoclonal Antibody [PSH0-26]](https://cdn.genprice.uk/products/992/68dd1c8d061270361ea81f70/imageurl/ha721306.webp)
HA721306 100 µL
ASC1 Recombinant Rabbit Monoclonal Antibody [PSH0-26]
Sign In for Pricing
View Details 
BNC472256-100 1x 100 µL
Aldo-keto Reductase Family 1 Member B1 (Adrenal Marker) (CPTC-AKR1B1-3), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC402054-100 1x 100 µL
Carcinoembryonic Antigen (CEA) / CD66 (rC66/1009), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
PA1570-Dylight550 100 µg
Anti-C-terminal-binding protein 1 CtBP1 Antibody Picoband®, Dylight550 Conjugate
Sign In for Pricing
View Details