Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Seizure protein 6 homolog (SEZ6), partial

This Recombinant Human Seizure protein 6 homolog (SEZ6), partial spans the amino acid sequence from region 768-832aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

SEZ-6; hSEZ-6; SEZ6

UniProt

Q53EL9

Expression Region

768-832aa

Tag

N-terminal HSA-tagged and C-terminal 10xHis-tagged

Source

Mammalian cell

Origin

Homo sapiens (Human)

Field of Research

Neuroscience

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

75 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

VTSCHDPGDVEHSRRLISSPKFPVGATVQYICDQGFVLMGSSILTCHDRQAGSPKWSDRAPKCLL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Sodium Propylparaben
TRC-S673265-25G 25 g

Sodium Propylparaben

Sign In for Pricing
View Details
NCX1 Recombinant Antibody, AbBy Fluor™ 680 Conjugated
bsm-61748R-BF680 100 µL

NCX1 Recombinant Antibody, AbBy Fluor™ 680 Conjugated

Sign In for Pricing
View Details
IL10RB (NM_000628) Human 3' UTR Clone
SC210527 10 µg

IL10RB (NM_000628) Human 3' UTR Clone

Sign In for Pricing
View Details
C5b-9 Rabbit Polyclonal Antibody
orb499686-01 50 μL

C5b-9 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
C5b-9 Rabbit Polyclonal Antibody
orb499686-02 100 µL

C5b-9 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
C5b-9 Rabbit Polyclonal Antibody
orb499686-03 200 µL

C5b-9 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details