Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Kit ligand (Kitlg), partial

This Recombinant Mouse Kit ligand (Kitlg), partial spans the amino acid sequence from region 26-189aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Hematopoietic growth factor KL; Mast cell growth factor; Steel factor; Stem cell factor; c-Kit ligand

UniProt

P20826

Expression Region

26-189aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Mus musculus (Mouse)

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

20.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

KEICGNPVTDNVKDITKLVANLPNDYMITLNYVAGMDVLPSHCWLRDMVIQLSLSLTTLLDKFSNISEGLSNYSIIDKLGKIVDDLVLCMEENAPKNIKESPKRPETRSFTPEEFFSIFNRSIDAFKDFMVASDTSDCVLSSTLGPEKDSRVSVTKPFMLPPVA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal EDA2R/TNFRSF27/XEDAR Antibody [Alexa Fluor 647]
NBP1-76710AF647 0.1 mL

Rabbit Polyclonal EDA2R/TNFRSF27/XEDAR Antibody [Alexa Fluor 647]

Sign In for Pricing
View Details
Human Siglec-8 Protein, Fc Tag
SI8-H5254-100ug 100 µg

Human Siglec-8 Protein, Fc Tag

Sign In for Pricing
View Details
Recombinant Reaction center protein L chain (pufL)
MBS1005200 Inquire

Recombinant Reaction center protein L chain (pufL)

Sign In for Pricing
View Details
TBL1X ORF Vector (Human) (pORF)
ORF010355 1.0 µg DNA

TBL1X ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
PTPRR Recombinant Antibody, PerCP Conjugated
bsm-62713R-PerCP 100 µL

PTPRR Recombinant Antibody, PerCP Conjugated

Sign In for Pricing
View Details
Herbicidal agent 2
HY-163298 1 Each

Herbicidal agent 2

Sign In for Pricing
View Details