Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Seizure protein 6 homolog (SEZ6), partial

This Recombinant Human Seizure protein 6 homolog (SEZ6), partial spans the amino acid sequence from region 705-767aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

SEZ-6; hSEZ-6; SEZ6

UniProt

Q53EL9

Expression Region

705-767aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Neuroscience

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

19.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

PRNDTCPELPEIPNGWKSPSQPELVHGTVVTYQCYPGYQVVGSSVLMCQWDLTWSEDLPSCQR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human γ-Synuclein/SNCG Protein
PKSH033274-01 10 µg

Recombinant Human γ-Synuclein/SNCG Protein

Sign In for Pricing
View Details
Recombinant Human γ-Synuclein/SNCG Protein
PKSH033274-02 50 µg

Recombinant Human γ-Synuclein/SNCG Protein

Sign In for Pricing
View Details
Tissue FFPE Sections, Ileum
CS808062 5x 5 µm

Tissue FFPE Sections, Ileum

Sign In for Pricing
View Details
SLC28A2 (NM_004212) Human Over-expression Lysate
LY418140 100 µg

SLC28A2 (NM_004212) Human Over-expression Lysate

Sign In for Pricing
View Details
CSNK1G1 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI4F12]
TA806333BM 100 µL

CSNK1G1 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI4F12]

Sign In for Pricing
View Details
FITC Conjugated Goat Affinity Purified Antibody to Mouse IgM,
FAF-445-1 1 mL

FITC Conjugated Goat Affinity Purified Antibody to Mouse IgM,

Sign In for Pricing
View Details