Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human STEAP1 protein (STEAP1)

This Recombinant Human STEAP1 protein (STEAP1) spans the amino acid sequence from region 1-339aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Six-transmembrane epithelial antigen of prostate 1

UniProt

Q9UHE8

Expression Region

1-339aa

Tag

C-terminal Twin-Strep-tagged

Source

In vitro E.coli expression system

Origin

Homo sapiens (Human)

Field of Research

Epigenetics & Chromatin

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

42.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MESRKDITNQEELWKMKPRRNLEEDDYLHKDTGETSMLKRPVLLHLHQTAHADEFDCPSELQHTQELFPQWHLPIKIAAIIASLTFLYTLLREVIHPLATSHQQYFYKIPILVINKVLPMVSITLLALVYLPGVIAAIVQLHNGTKYKKFPHWLDKWMLTRKQFGLLSFFFAVLHAIYSLSYPMRRSYRYKLLNWAYQQVQQNKEDAWIEHDVWRMEIYVSLGIVGLAILALLAVTSIPSVSDSLTWREFHYIQSKLGIVSLLLGTIHALIFAWNKWIDIKQFVWYTPPTFMIAVFLPIVVLIFKSILFLPCLRKKILKIRHGWEDVTKINKTEICSQL

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal CD40/TNFRSF5 Antibody (OTI8B8) [Alexa Fluor 532]
NBP2-70378AF532 0.1 mL

Mouse Monoclonal CD40/TNFRSF5 Antibody (OTI8B8) [Alexa Fluor 532]

Sign In for Pricing
View Details
hsa-miR-3648 miRNA Antagomir
MBS8317060-01 10 nmol

hsa-miR-3648 miRNA Antagomir

Sign In for Pricing
View Details
hsa-miR-3648 miRNA Antagomir
MBS8317060-02 20 nmol

hsa-miR-3648 miRNA Antagomir

Sign In for Pricing
View Details
hsa-miR-3648 miRNA Antagomir
MBS8317060-03 5x 20 nmol

hsa-miR-3648 miRNA Antagomir

Sign In for Pricing
View Details
Recombinant Human Bromodomain-containing protein 4 (BRD4), partial
CSB-YP002802HU3b0-01 20 µg

Recombinant Human Bromodomain-containing protein 4 (BRD4), partial

Sign In for Pricing
View Details
Recombinant Human Bromodomain-containing protein 4 (BRD4), partial
CSB-YP002802HU3b0-02 100 µg

Recombinant Human Bromodomain-containing protein 4 (BRD4), partial

Sign In for Pricing
View Details