Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human High affinity immunoglobulin epsilon receptor subunit beta (MS4A2)

This Recombinant Human High affinity immunoglobulin epsilon receptor subunit beta (MS4A2) spans the amino acid sequence from region 1-244aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Fc epsilon receptor I beta-chain; IgE Fc receptor subunit beta; Membrane-spanning 4-domains subfamily A member 2

UniProt

Q01362

Expression Region

1-244aa

Tag

N-terminal 10xHis-tagged

Source

In vitro E.coli expression system

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

32.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MDTESNRRANLALPQEPSSVPAFEVLEISPQEVSSGRLLKSASSPPLHTWLTVLKKEQEFLGVTQILTAMICLCFGTVVCSVLDISHIEGDIFSSFKAGYPFWGAIFFSISGMLSIISERRNATYLVRGSLGANTASSIAGGTGITILIINLKKSLAYIHIHSCQKFFETKCFMASFSTEIVVMMLFLTILGLGSAVSLTICGAGEELKGNKVPEDRVYEELNIYSATYSELEDPGEMSPPIDL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Chicken Fatty Acid Binding Protein 1 (FABP1) ELISA Kit
MBS9397677-01 48 Well

Chicken Fatty Acid Binding Protein 1 (FABP1) ELISA Kit

Sign In for Pricing
View Details
Chicken Fatty Acid Binding Protein 1 (FABP1) ELISA Kit
MBS9397677-02 96 Well

Chicken Fatty Acid Binding Protein 1 (FABP1) ELISA Kit

Sign In for Pricing
View Details
Chicken Fatty Acid Binding Protein 1 (FABP1) ELISA Kit
MBS9397677-03 5x 96 Well

Chicken Fatty Acid Binding Protein 1 (FABP1) ELISA Kit

Sign In for Pricing
View Details
Chicken Fatty Acid Binding Protein 1 (FABP1) ELISA Kit
MBS9397677-04 10x 96 Well

Chicken Fatty Acid Binding Protein 1 (FABP1) ELISA Kit

Sign In for Pricing
View Details
Cat Forkhead Box Protein P1 ELISA Kit
MBS097317 Inquire

Cat Forkhead Box Protein P1 ELISA Kit

Sign In for Pricing
View Details
Phospho-PLCg1 (Tyr783) (Clone: C4) rabbit mAb FITC conjugate
12-4098-10 10 Tests

Phospho-PLCg1 (Tyr783) (Clone: C4) rabbit mAb FITC conjugate

Sign In for Pricing
View Details