Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Interferon-induced transmembrane protein 1 (IFITM1)

This Recombinant Human Interferon-induced transmembrane protein 1 (IFITM1) spans the amino acid sequence from region 1-125aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Dispanin subfamily A member 2a; Interferon-induced protein 17; Interferon-inducible protein 9-27; Leu-13 antigen

UniProt

P13164

Expression Region

1-125aa

Tag

N-terminal 10xHis-tagged

Source

In vitro E.coli expression system

Origin

Homo sapiens (Human)

Field of Research

Infectious Disease & Virology; Immunology & Inflammation

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

15.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MHKEEHEVAVLGPPPSTILPRSTVINIHSETSVPDHVVWSLFNTLFLNWCCLGFIAFAYSVKSRDRKMVGDVTGAQAYASTAKCLNIWALILGILMTIGFILLLVFGSVTVYHIMLQIIQEKRGY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal KIF3B Antibody
NBP3-05143-20ul 20 µL

Rabbit Polyclonal KIF3B Antibody

Sign In for Pricing
View Details
RBM38 Antibody
OACD06925-1ML 1 mL

RBM38 Antibody

Sign In for Pricing
View Details
CADM3 Antibody
GWB-MR581E 50 µg

CADM3 Antibody

Sign In for Pricing
View Details
OCRL Antibody : HRP (OAAF05889-HRP)
OAAF05889-100UG-HRP 100 µg

OCRL Antibody : HRP (OAAF05889-HRP)

Sign In for Pricing
View Details
Human Collagen I ELISA Kit (Ready to Use)
orb550300-01 48 Tests

Human Collagen I ELISA Kit (Ready to Use)

Sign In for Pricing
View Details
Human Collagen I ELISA Kit (Ready to Use)
orb550300-02 96 Tests

Human Collagen I ELISA Kit (Ready to Use)

Sign In for Pricing
View Details