Recombinant Human Interferon-induced transmembrane protein 1 (IFITM1)
This Recombinant Human Interferon-induced transmembrane protein 1 (IFITM1) spans the amino acid sequence from region 1-125aa. Purity: Greater than 85% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
Dispanin subfamily A member 2a; Interferon-induced protein 17; Interferon-inducible protein 9-27; Leu-13 antigen
UniProt
P13164
Expression Region
1-125aa
Tag
N-terminal 10xHis-tagged
Source
In vitro E.coli expression system
Origin
Homo sapiens (Human)
Field of Research
Infectious Disease & Virology; Immunology & Inflammation
Purity
Greater than 85% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Molecular Weight
15.5 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
AA Sequence
MHKEEHEVAVLGPPPSTILPRSTVINIHSETSVPDHVVWSLFNTLFLNWCCLGFIAFAYSVKSRDRKMVGDVTGAQAYASTAKCLNIWALILGILMTIGFILLLVFGSVTVYHIMLQIIQEKRGY
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
A11954-1-Dylight550 100 µg
Anti-NeuN/Rbfox3 Antibody Picoband®, Dylight550 Conjugate
Sign In for Pricing
View Details 