Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Vascular endothelial growth factor D (Vegfd)

This Recombinant Rat Vascular endothelial growth factor D (Vegfd) spans the amino acid sequence from region 94-210aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

C-Fos-induced growth factor

UniProt

O35251

Expression Region

94-210aa

Tag

N-terminal hFc1-tagged

Source

Yeast

Origin

Rattus norvegicus (Rat)

Field of Research

Cardiovascular Research; Stem Cell & Developmental Biology

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

39.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

FAATFYDTETLKVIDEEWQRTQCSPRETCVEVASELGKTTNTFFKPPCVNVFRCGGCCNEESVMCMNTSTSYISKQLFEISVPLTSVPELVPVKIANHTGCKCLPTGPRHPYSIIRR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ITPR Mouse Monoclonal Antibody
orb2957984-01 50 µg

ITPR Mouse Monoclonal Antibody

Sign In for Pricing
View Details
ITPR Mouse Monoclonal Antibody
orb2957984-02 100 µg

ITPR Mouse Monoclonal Antibody

Sign In for Pricing
View Details
ITPR Mouse Monoclonal Antibody
orb2957984-03 1 mg

ITPR Mouse Monoclonal Antibody

Sign In for Pricing
View Details
GRK2 Protein, Human, Recombinant (His & GST Tag)
E45H50922I6-50 50 µg

GRK2 Protein, Human, Recombinant (His & GST Tag)

Sign In for Pricing
View Details
CCDC68 Rabbit Polyclonal Antibody (BF647)
orb1589971 100 µL

CCDC68 Rabbit Polyclonal Antibody (BF647)

Sign In for Pricing
View Details
CYP17A1 Antibody
C12247-01 50 μL

CYP17A1 Antibody

Sign In for Pricing
View Details