Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Coagulation factor IX (F9), partial

This Recombinant Human Coagulation factor IX (F9), partial spans the amino acid sequence from region 93-129aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Christmas factor; Plasma thromboplastin component

UniProt

P00740

Expression Region

93-129aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Cardiovascular Research

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

6.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

DGDQCESNPCLNGGSCKDDINSYECWCPFGFEGKNCE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ALPP polyclonal antibody
orb645797-01 50 μL

ALPP polyclonal antibody

Sign In for Pricing
View Details
ALPP polyclonal antibody
orb645797-02 100 µL

ALPP polyclonal antibody

Sign In for Pricing
View Details
ALPP polyclonal antibody
orb645797-03 200 µL

ALPP polyclonal antibody

Sign In for Pricing
View Details
Lentiviral mouse Btg1c shRNA (UAS) - Lentiviral mouse Btg1c shRNA (UAS) (100)
GTR15274266 1 Vial

Lentiviral mouse Btg1c shRNA (UAS) - Lentiviral mouse Btg1c shRNA (UAS) (100)

Sign In for Pricing
View Details
Acy3 3'UTR Luciferase Stable Cell Line
TU200240 1.0 mL

Acy3 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
CDK1/CDC2 (Phospho-Thr14) Antibody
MBS8585267-01 0.1 mg

CDK1/CDC2 (Phospho-Thr14) Antibody

Sign In for Pricing
View Details