Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Coagulation factor IX (F9), partial

This Recombinant Human Coagulation factor IX (F9), partial spans the amino acid sequence from region 93-129aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Christmas factor; Plasma thromboplastin component

UniProt

P00740

Expression Region

93-129aa

Tag

C-terminal 10xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cardiovascular Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

12.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

DGDQCESNPCLNGGSCKDDINSYECWCPFGFEGKNCE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SLCO1B7 Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC)
LV786045 1.0 µg DNA

SLCO1B7 Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC)

Sign In for Pricing
View Details
RPLP1P10 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)
LV781502 1.0 µg DNA

RPLP1P10 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)

Sign In for Pricing
View Details
Nicotinic Acid Adenine Dinucleotide Phosphate (NAADP) Magnetic Fluorescence Assay Kit
MBS2160449-01 96 Tests

Nicotinic Acid Adenine Dinucleotide Phosphate (NAADP) Magnetic Fluorescence Assay Kit

Sign In for Pricing
View Details
Nicotinic Acid Adenine Dinucleotide Phosphate (NAADP) Magnetic Fluorescence Assay Kit
MBS2160449-02 5x 96 Tests

Nicotinic Acid Adenine Dinucleotide Phosphate (NAADP) Magnetic Fluorescence Assay Kit

Sign In for Pricing
View Details
Nicotinic Acid Adenine Dinucleotide Phosphate (NAADP) Magnetic Fluorescence Assay Kit
MBS2160449-03 10x 96 Tests

Nicotinic Acid Adenine Dinucleotide Phosphate (NAADP) Magnetic Fluorescence Assay Kit

Sign In for Pricing
View Details
SLC25A31 Antibody
MBS9510212-01 0.05 mL

SLC25A31 Antibody

Sign In for Pricing
View Details