Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Coagulation factor IX (F9), partial

This Recombinant Human Coagulation factor IX (F9), partial spans the amino acid sequence from region 93-171aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Christmas factor; Plasma thromboplastin component

UniProt

P00740

Expression Region

93-171aa

Tag

C-terminal hFc1-tagged

Source

Mammalian cell

Origin

Homo sapiens (Human)

Field of Research

Cardiovascular Research

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

38.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

DGDQCESNPCLNGGSCKDDINSYECWCPFGFEGKNCELDVTCNIKNGRCEQFCKNSADNKVVCSCTEGYRLAENQKSCE

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

4-Methoxyphenyl 4-O-[2-O-acetyl-3,4-di-O- (2,3,4,6-tetra-O-acetyl-a-D-mannopyranosyl) -6-O-benzyl-b-D-mannopyrannosyl]-3,6-di-O-acetyl-2-deoxy-2-phthalimido-b-D-glucopyranoside
297487-01 1 mg

4-Methoxyphenyl 4-O-[2-O-acetyl-3,4-di-O- (2,3,4,6-tetra-O-acetyl-a-D-mannopyranosyl) -6-O-benzyl-b-D-mannopyrannosyl]-3,6-di-O-acetyl-2-deoxy-2-phthalimido-b-D-glucopyranoside

Sign In for Pricing
View Details
4-Methoxyphenyl 4-O-[2-O-acetyl-3,4-di-O- (2,3,4,6-tetra-O-acetyl-a-D-mannopyranosyl) -6-O-benzyl-b-D-mannopyrannosyl]-3,6-di-O-acetyl-2-deoxy-2-phthalimido-b-D-glucopyranoside
297487-02 2 mg

4-Methoxyphenyl 4-O-[2-O-acetyl-3,4-di-O- (2,3,4,6-tetra-O-acetyl-a-D-mannopyranosyl) -6-O-benzyl-b-D-mannopyrannosyl]-3,6-di-O-acetyl-2-deoxy-2-phthalimido-b-D-glucopyranoside

Sign In for Pricing
View Details
4-Methoxyphenyl 4-O-[2-O-acetyl-3,4-di-O- (2,3,4,6-tetra-O-acetyl-a-D-mannopyranosyl) -6-O-benzyl-b-D-mannopyrannosyl]-3,6-di-O-acetyl-2-deoxy-2-phthalimido-b-D-glucopyranoside
297487-03 5 mg

4-Methoxyphenyl 4-O-[2-O-acetyl-3,4-di-O- (2,3,4,6-tetra-O-acetyl-a-D-mannopyranosyl) -6-O-benzyl-b-D-mannopyrannosyl]-3,6-di-O-acetyl-2-deoxy-2-phthalimido-b-D-glucopyranoside

Sign In for Pricing
View Details
SHC1 Recombinant Antibody, FITC Conjugated
bsm-61677R-FITC-TR 20 µL

SHC1 Recombinant Antibody, FITC Conjugated

Sign In for Pricing
View Details
Pigeon Frizzled-2 (FZD2) ELISA Kit
MBS9925649 Inquire

Pigeon Frizzled-2 (FZD2) ELISA Kit

Sign In for Pricing
View Details
FLUOR DE LYS®-Succinyl, Desuccinylase Substrate
BML-KI590-0050 50 μL

FLUOR DE LYS®-Succinyl, Desuccinylase Substrate

Sign In for Pricing
View Details