Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Coagulation factor X (F10), partial

This Recombinant Human Coagulation factor X (F10), partial spans the amino acid sequence from region 86-122aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Stuart factor; Stuart-Prower factor

UniProt

P00742

Expression Region

86-122aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Cardiovascular Research

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

5.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

DGDQCETSPCQNQGKCKDGLGEYTCTCLEGFEGKNCE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IGF2BP1 (Insulin-Like Growth Factor 2 mRNA-binding Protein 1)
483381 100 µL

IGF2BP1 (Insulin-Like Growth Factor 2 mRNA-binding Protein 1)

Sign In for Pricing
View Details
RT31 Polyclonal Antibody
MBS8529683-01 0.1 mg

RT31 Polyclonal Antibody

Sign In for Pricing
View Details
RT31 Polyclonal Antibody
MBS8529683-02 0.1 mL (AF635)

RT31 Polyclonal Antibody

Sign In for Pricing
View Details
RT31 Polyclonal Antibody
MBS8529683-03 0.1 mL (AF610)

RT31 Polyclonal Antibody

Sign In for Pricing
View Details
RT31 Polyclonal Antibody
MBS8529683-04 0.1 mL (AF405S)

RT31 Polyclonal Antibody

Sign In for Pricing
View Details
RT31 Polyclonal Antibody
MBS8529683-05 0.1 mL (AF405L)

RT31 Polyclonal Antibody

Sign In for Pricing
View Details