Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Coagulation factor X (F10), partial

This Recombinant Human Coagulation factor X (F10), partial spans the amino acid sequence from region 86-122aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Stuart factor; Stuart-Prower factor

UniProt

P00742

Expression Region

86-122aa

Tag

C-terminal 10xHis-tagged

Source

Mammalian cell

Origin

Homo sapiens (Human)

Field of Research

Cardiovascular Research

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

5.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

DGDQCETSPCQNQGKCKDGLGEYTCTCLEGFEGKNCE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

H TLR2 (CD282) Expression Lentivirus
LVP744 1x 10^7 IFU/mL - 200 μL

H TLR2 (CD282) Expression Lentivirus

Sign In for Pricing
View Details
EFCAB6 Recombinant Protein Antigen
NBP1-84237PEP 100 µL

EFCAB6 Recombinant Protein Antigen

Sign In for Pricing
View Details
Anti-TBP-1/PSMC3 Antibody Picoband® (monoclonal, 4D3), APC Conjugate
M07208-2-APC 100 µg/Vial

Anti-TBP-1/PSMC3 Antibody Picoband® (monoclonal, 4D3), APC Conjugate

Sign In for Pricing
View Details
NCOR1 Antibody
CSB-PA936378-01 50 μL

NCOR1 Antibody

Sign In for Pricing
View Details
NCOR1 Antibody
CSB-PA936378-02 100 µL

NCOR1 Antibody

Sign In for Pricing
View Details
Vascular Endothelial Growth Factor D
550619 200 µL

Vascular Endothelial Growth Factor D

Sign In for Pricing
View Details