Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pig Complement C3 (C3), partial

This Recombinant Pig Complement C3 (C3), partial spans the amino acid sequence from region 1001-1302aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

UniProt

P01025

Expression Region

1001-1302aa

Tag

C-terminal 6xHis-tagged

Source

Yeast

Origin

Sus scrofa (Pig)

Field of Research

Neuroscience; Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

35.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

LIQTPSGCGEQNMIGMTPTVIAVHYLDSTEQWEKFGLEKRQEALELIKKGYTQQLAFRQKNSAFAAFQDRLSSTLLTAYVVKVFAMAANLIAIDSQVLCGAVKWLILEKQKPDGVFEENGPVIHQEMIGGFKNTEEKDVSLTAFVLIALQEAKDICEPQVNSLLRSINKARDFLADYYLELKRPYTVAIAGYALALSDKLDEPFLNKLLSTAKERNRWEEPGQKLHNVEATSYALLALLVVKDFDSVPPIVRWLNEQRYYGGGYGSTQATFMVFQALAQYQKDVPDHKDLNLDVSIHLPSRS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BUBR1 Rabbit mAb Antibody
orb3014526 100 µL

BUBR1 Rabbit mAb Antibody

Sign In for Pricing
View Details
Rabbit Polyclonal TMEM147 Antibody [mFluor Violet 610 SE]
NBP2-82028MFV610 0.1 mL

Rabbit Polyclonal TMEM147 Antibody [mFluor Violet 610 SE]

Sign In for Pricing
View Details
IL6 Antibody (HRP)
KH-367-01 50 μL

IL6 Antibody (HRP)

Sign In for Pricing
View Details
IL6 Antibody (HRP)
KH-367-02 100 µL

IL6 Antibody (HRP)

Sign In for Pricing
View Details
IL6 Antibody (HRP)
KH-367-03 1 mL

IL6 Antibody (HRP)

Sign In for Pricing
View Details
Ammonium 50ppm as N - 1L
NH4N50 1 L

Ammonium 50ppm as N - 1L

Sign In for Pricing
View Details