Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Interferon gamma (Ifng)

This Recombinant Rat Interferon gamma (Ifng) spans the amino acid sequence from region 23-156aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

IFN-gamma; Ifng

UniProt

P01581

Expression Region

23-156aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Rattus norvegicus (Rat)

Field of Research

Infectious Disease & Virology; Immunology & Inflammation

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

17.0 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

QGTLIESLESLKNYFNSSSMDAMEGKSLLLDIWRNWQKDGNTKILESQIISFYLRLFEVLKDNQAISNNISVIESHLITNFFSNSKAKKDAFMSIAKFEVNNPQIQHKAVNELIRVIHQLSPESSLRKRKRSRC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

2-Isopropoxy-N-[3- (2-phenoxyethoxy) benzyl]aniline
sc-308121 500 mg

2-Isopropoxy-N-[3- (2-phenoxyethoxy) benzyl]aniline

Sign In for Pricing
View Details
beta 1 Sodium Potassium ATPase (ATP1B1) (NM_001677) Human Over-expression Lysate
LY419810 100 µg

beta 1 Sodium Potassium ATPase (ATP1B1) (NM_001677) Human Over-expression Lysate

Sign In for Pricing
View Details
HSF1 (Heat Shock Transcription Factor 1, HSTF1) (MaxLight 750) discontinued
247272-ML750 100 µL

HSF1 (Heat Shock Transcription Factor 1, HSTF1) (MaxLight 750) discontinued

Sign In for Pricing
View Details
PDE4B2 (h) -PR
sc-41599-PR 10 µM - 20 µL

PDE4B2 (h) -PR

Sign In for Pricing
View Details
DPAGT1 Antibody - N-terminal
OAPB01473-100UG 0.1 mg

DPAGT1 Antibody - N-terminal

Sign In for Pricing
View Details
Hamster Cluster of Differentiation 160 ELISA Kit
MBS086015-01 48 Well

Hamster Cluster of Differentiation 160 ELISA Kit

Sign In for Pricing
View Details