Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Interferon gamma (Ifng)

This Recombinant Rat Interferon gamma (Ifng) spans the amino acid sequence from region 23-156aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

IFN-gamma; Ifng

UniProt

P01581

Expression Region

23-156aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Rattus norvegicus (Rat)

Field of Research

Infectious Disease & Virology; Immunology & Inflammation

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

22.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

QGTLIESLESLKNYFNSSSMDAMEGKSLLLDIWRNWQKDGNTKILESQIISFYLRLFEVLKDNQAISNNISVIESHLITNFFSNSKAKKDAFMSIAKFEVNNPQIQHKAVNELIRVIHQLSPESSLRKRKRSRC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Amotl2 (NM_019764) Mouse Tagged Lenti ORF Clone
MR207385L4 10 µg

Amotl2 (NM_019764) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
CCNG1P1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
15400061 1.0 µg DNA

CCNG1P1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
Sprouty 4 Recombinant Antibody, PE-Cy7 Conjugated
bsm-61880R-PE-Cy7-TR 20 µL

Sprouty 4 Recombinant Antibody, PE-Cy7 Conjugated

Sign In for Pricing
View Details
Lentiviral mouse Fam43a shRNA (UAS) - Lentiviral mouse Fam43a shRNA (UAS, RFP) plasmid
GTR15178813 1 Vial

Lentiviral mouse Fam43a shRNA (UAS) - Lentiviral mouse Fam43a shRNA (UAS, RFP) plasmid

Sign In for Pricing
View Details
Tert-Butyl 6-piperazin-1-ypyridine-2-carboxylate
OR97554 1 g

Tert-Butyl 6-piperazin-1-ypyridine-2-carboxylate

Sign In for Pricing
View Details
GFAP Mouse mAb, BF350 conjugated
orb2837819 100 µL

GFAP Mouse mAb, BF350 conjugated

Sign In for Pricing
View Details