Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Interferon gamma (Ifng)

This Recombinant Rat Interferon gamma (Ifng) spans the amino acid sequence from region 23-156aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

IFN-gamma; Ifng

UniProt

P01581

Expression Region

23-156aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Rattus norvegicus (Rat)

Field of Research

Infectious Disease & Virology; Immunology & Inflammation

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

22.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

QGTLIESLESLKNYFNSSSMDAMEGKSLLLDIWRNWQKDGNTKILESQIISFYLRLFEVLKDNQAISNNISVIESHLITNFFSNSKAKKDAFMSIAKFEVNNPQIQHKAVNELIRVIHQLSPESSLRKRKRSRC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Active HIV1 Protease Recombinant (GST-tagged)
7849-100 100 µg

Active HIV1 Protease Recombinant (GST-tagged)

Sign In for Pricing
View Details
SuLT1A4 (NM_001017390) Human Tagged ORF Clone Lentiviral Particle
RC209931L4V 200 µL

SuLT1A4 (NM_001017390) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Vmn2r1 ORF Vector (Mouse) (pORF)
49726014 1.0 µg DNA

Vmn2r1 ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
Copper Glycinate
583356 100 g

Copper Glycinate

Sign In for Pricing
View Details
RhCG Rabbit Polyclonal Antibody
E53P06248 100 µL

RhCG Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Human Forkhead box protein F2 (C-His)
32-10780-500 500 µg

Recombinant Human Forkhead box protein F2 (C-His)

Sign In for Pricing
View Details