Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Tumor necrosis factor (Tnf), partial

This Recombinant Mouse Tumor necrosis factor (Tnf), partial spans the amino acid sequence from region 80-235aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Cachectin; TNF-alpha; Tumor necrosis factor ligand superfamily member 2

UniProt

P06804

Expression Region

80-235aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Mus musculus (Mouse)

Field of Research

Cancer Biology; Immunology & Inflammation

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

19.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

LRSSSQNSSDKPVAHVVANHQVEEQLEWLSQRANALLANGMDLKDNQLVVPADGLYLVYSQVLFKGQGCPDYVLLTHTVSRFAISYQEKVNLLSAVKSPCPKDTPEGAELKPWYEPIYLGGVFQLEKGDQLSAEVNLPKYLDFAESGQVYFGVIAL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NAPSIN A (NAPSA) Mouse Monoclonal Antibody [Clone ID: OTI2F11]
CF807998 100 µg

NAPSIN A (NAPSA) Mouse Monoclonal Antibody [Clone ID: OTI2F11]

Sign In for Pricing
View Details
NLGN3 Protein Vector (Mouse) (pPM-C-His)
PV205729 500 ng

NLGN3 Protein Vector (Mouse) (pPM-C-His)

Sign In for Pricing
View Details
Mouse Monoclonal CXCL13/BLC/BCA-1 Antibody (MM0212-12A2) [DyLight 550]
NBP2-12222R 0.1 mL

Mouse Monoclonal CXCL13/BLC/BCA-1 Antibody (MM0212-12A2) [DyLight 550]

Sign In for Pricing
View Details
LAIR1, Mouse (HEK293, Fc)
HY-P74783 1 Each

LAIR1, Mouse (HEK293, Fc)

Sign In for Pricing
View Details
Recombinant Human AMPK (A1/B2/G1) (C-His tag)
MBS4160019-01 0.01 mg

Recombinant Human AMPK (A1/B2/G1) (C-His tag)

Sign In for Pricing
View Details
Recombinant Human AMPK (A1/B2/G1) (C-His tag)
MBS4160019-02 5x 0.01 mg

Recombinant Human AMPK (A1/B2/G1) (C-His tag)

Sign In for Pricing
View Details