Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Tumor necrosis factor (Tnf), partial

This Recombinant Mouse Tumor necrosis factor (Tnf), partial spans the amino acid sequence from region 80-235aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Cachectin; TNF-alpha; Tumor necrosis factor ligand superfamily member 2

UniProt

P06804

Expression Region

80-235aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Mus musculus (Mouse)

Field of Research

Cancer Biology; Immunology & Inflammation

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

19.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

LRSSSQNSSDKPVAHVVANHQVEEQLEWLSQRANALLANGMDLKDNQLVVPADGLYLVYSQVLFKGQGCPDYVLLTHTVSRFAISYQEKVNLLSAVKSPCPKDTPEGAELKPWYEPIYLGGVFQLEKGDQLSAEVNLPKYLDFAESGQVYFGVIAL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

USP Sol. Sulfanilic Acid TS - 100ML
USP6001 100 mL

USP Sol. Sulfanilic Acid TS - 100ML

Sign In for Pricing
View Details
PACAP-38 Polyclonal Antibody, PerCP-Cy5.5 Conjugated
bs-0200R-PerCP-Cy5.5 100 µL

PACAP-38 Polyclonal Antibody, PerCP-Cy5.5 Conjugated

Sign In for Pricing
View Details
RABIF Antibody, HRP conjugated
A32721-50UG 50 µg

RABIF Antibody, HRP conjugated

Sign In for Pricing
View Details
ZNF711/ZNF5 Rabbit Polyclonal Antibody (RBITC)
orb1084514 100 µL

ZNF711/ZNF5 Rabbit Polyclonal Antibody (RBITC)

Sign In for Pricing
View Details
Human TSHB / Thyrotropin Subunit Beta Recombinant Protein
MBS2901816 Inquire

Human TSHB / Thyrotropin Subunit Beta Recombinant Protein

Sign In for Pricing
View Details
3-Chloro-2,6-difluoropyridine
PC902115-01 1 g

3-Chloro-2,6-difluoropyridine

Sign In for Pricing
View Details