Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Interleukin-8 (CXCL8), partial (Active)

This Recombinant Human Interleukin-8 (CXCL8), partial spans the amino acid sequence from region 28-99aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Interleukin-8; IL-8; C-X-C motif chemokine 8; Chemokine (C-X-C motif) ligand 8; Emoctakin; Granulocyte chemotactic protein 1 (GCP-1) ; Monocyte-derived neutrophil chemotactic factor (MDNCF) ; CXCL8; IL8

UniProt

P10145

Expression Region

28-99aa

Tag

C-terminal 10xHis-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Purity

Greater than 95% as determined by SDS-PAGE.

Bioactivity

Measured by its binding ability in a functional ELISA. Immobilized Human CXCL8 at 2 μg/mL can bind Anti-CXCL8 recombinant antibody. The EC50 is 43.95-46.76 ng/mL.

Form

Lyophilized powder

Molecular Weight

10.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SAKELRCQCIKTYSKPFHPKFIKELRVIESGPHCANTEIIVKLSDGRELCLDPKENWVQRVVEKFLKRAENS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bovine Serum Albumin – Cohn Fraction V, Endotoxin Low, pH – 5.2
7910-5 5 g

Bovine Serum Albumin – Cohn Fraction V, Endotoxin Low, pH – 5.2

Sign In for Pricing
View Details
Srp54c sgRNA CRISPR Lentivector (Mouse) (Target 3)
K4324904 1.0 µg DNA

Srp54c sgRNA CRISPR Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details
W/W050/NL441/PP-210X297-1 Marine & IMO Signs (No Adhesive)
301106 1 Pack (1 Panel (s) x 1 Pack)

W/W050/NL441/PP-210X297-1 Marine & IMO Signs (No Adhesive)

Sign In for Pricing
View Details
MMEL1 (NM_033467) Human Over-expression Lysate
LC432384 20 µg

MMEL1 (NM_033467) Human Over-expression Lysate

Sign In for Pricing
View Details
1300010F03Rik Protein Vector (Mouse) (pPM-C-HA)
PV146544 500 ng

1300010F03Rik Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
Triclabendazole
B1860-5.1 10 mM (in 1mL DMSO)

Triclabendazole

Sign In for Pricing
View Details