Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Interleukin-8 (CXCL8), partial (Active)

This Recombinant Human Interleukin-8 (CXCL8), partial spans the amino acid sequence from region 28-99aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Interleukin-8; IL-8; C-X-C motif chemokine 8; Chemokine (C-X-C motif) ligand 8; Emoctakin; Granulocyte chemotactic protein 1 (GCP-1) ; Monocyte-derived neutrophil chemotactic factor (MDNCF) ; CXCL8; IL8

UniProt

P10145

Expression Region

28-99aa

Tag

C-terminal 10xHis-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Purity

Greater than 95% as determined by SDS-PAGE.

Bioactivity

Measured by its binding ability in a functional ELISA. Immobilized Human CXCL8 at 2 μg/mL can bind Anti-CXCL8 recombinant antibody. The EC50 is 43.95-46.76 ng/mL.

Form

Lyophilized powder

Molecular Weight

10.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SAKELRCQCIKTYSKPFHPKFIKELRVIESGPHCANTEIIVKLSDGRELCLDPKENWVQRVVEKFLKRAENS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TUBA4A Monoclonal Antibody
E10-32012 100 µg -100 µL

TUBA4A Monoclonal Antibody

Sign In for Pricing
View Details
Human Deiodinase, Iodothyronine, Type II ELISA Kit (DIO2)
RK01269 96 Tests

Human Deiodinase, Iodothyronine, Type II ELISA Kit (DIO2)

Sign In for Pricing
View Details
LPP Double Nickase Plasmid (m2)
sc-431678-NIC-2 20 µg

LPP Double Nickase Plasmid (m2)

Sign In for Pricing
View Details
H-LEHHHHHH-OH
PP47755-01 1 mg

H-LEHHHHHH-OH

Sign In for Pricing
View Details
H-LEHHHHHH-OH
PP47755-02 10 mg

H-LEHHHHHH-OH

Sign In for Pricing
View Details
H-LEHHHHHH-OH
PP47755-03 100 mg

H-LEHHHHHH-OH

Sign In for Pricing
View Details