Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human V-type proton ATPase subunit C 1 (ATP6V1C1)

This Recombinant Human V-type proton ATPase subunit C 1 (ATP6V1C1) spans the amino acid sequence from region 2-382aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Vacuolar proton pump subunit C 1

UniProt

P21283

Expression Region

2-382aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Neuroscience

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

50.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

TEFWLISAPGEKTCQQTWEKLHAATSKNNNLAVTSKFNIPDLKVGTLDVLVGLSDELAKLDAFVEGVVKKVAQYMADVLEDSKDKVQENLLANGVDLVTYITRFQWDMAKYPIKQSLKNISEIIAKGVTQIDNDLKSRASAYNNLKGNLQNLERKNAGSLLTRSLAEIVKKDDFVLDSEYLVTLLVVVPKLNHNDWIKQYETLAEMVVPRSSNVLSEDQDSYLCNVTLFRKAVDDFRHKARENKFIVRDFQYNEEEMKADKEEMNRLSTDKKKQFGPLVRWLKVNFSEAFIAWIHVKALRVFVESVLRYGLPVNFQAMLLQPNKKTLKKLREVLHELYKHLDSSAAAIIDAPMDIPGLNLSQQEYYPYVYYKIDCNLLEFK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IN-Q6S09 (>90%)
TRC-I499615-2.5MG 2.5 mg

IN-Q6S09 (>90%)

Sign In for Pricing
View Details
Prohibitin (Mitochondrial Marker) (PHB/1882), CF647 conjugate, 0.1mg/mL
BNC471882-500 1x 500 µL

Prohibitin (Mitochondrial Marker) (PHB/1882), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
2-(Undecyloxy)-ethanol
TRC-U789025-5G 5 g

2-(Undecyloxy)-ethanol

Sign In for Pricing
View Details
PNPT1 Antibody
8C17774-AAT 50 µg

PNPT1 Antibody

Sign In for Pricing
View Details
KTEL1 (POGLUT1) (NM_020231) Human Over-expression Lysate
LY402765 100 µg

KTEL1 (POGLUT1) (NM_020231) Human Over-expression Lysate

Sign In for Pricing
View Details
Human TNF-alpha, Tag Free
HA210760-01 20 µg

Human TNF-alpha, Tag Free

Sign In for Pricing
View Details