Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Pituitary homeobox 1 (Pitx1)

This Recombinant Mouse Pituitary homeobox 1 (Pitx1) spans the amino acid sequence from region 1-315aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Hindlimb-expressed homeobox protein backfoot; Homeobox protein P-OTX; Homeobox protein PITX1; Paired-like homeodomain transcription factor 1; Pituitary OTX-related factor

UniProt

P70314

Expression Region

1-315aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Neuroscience; Stem Cell & Developmental Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

40.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MDAFKGGMSLERLPEGLRPPPPPPHDMGPSFHLARAADPREPLENSASESSDADLPDKERGGEAKGPEDGGAGSAGCGGGAEDPAKKKKQRRQRTHFTSQQLQELEATFQRNRYPDMSMREEIAVWTNLTEPRVRVWFKNRRAKWRKRERNQQLDLCKGGYVPQFSGLVQPYEDVYAAGYSYNNWAAKSLAPAPLSTKSFTFFNSMSPLSSQSMFSAPSSISSMTMPSSMGPGAVPGMPNSGLNNINNLTGSSLNSAMSPGACPYGTPASPYSVYRDTCNSSLASLRLKSKQHSSFGYGGLQGPASGLNACQYNS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ITS1-ITS2 Library Preparation Kit for Illumina (Set D)
71040 96 Preparations

ITS1-ITS2 Library Preparation Kit for Illumina (Set D)

Sign In for Pricing
View Details
METT11D1 (METTL17) (NM_001029991) Human Over-expression Lysate
LC422275 20 µg

METT11D1 (METTL17) (NM_001029991) Human Over-expression Lysate

Sign In for Pricing
View Details
Gamma-Butyrobetaine Hydrochloride
TRC-B759500-1G 1 g

Gamma-Butyrobetaine Hydrochloride

Sign In for Pricing
View Details
Human Leptin Recombinant Rabbit monoclonal Antibody
HA723421 100 µL

Human Leptin Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
PE/Elab Fluor® 594 Anti-Mouse CD16/32 Antibody[2.4G2]
E-AB-F0997UP-01 25 µg

PE/Elab Fluor® 594 Anti-Mouse CD16/32 Antibody[2.4G2]

Sign In for Pricing
View Details
PE/Elab Fluor® 594 Anti-Mouse CD16/32 Antibody[2.4G2]
E-AB-F0997UP-02 100 µg

PE/Elab Fluor® 594 Anti-Mouse CD16/32 Antibody[2.4G2]

Sign In for Pricing
View Details