Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Interferon beta (Ifnb1)

This Recombinant Rat Interferon beta (Ifnb1) spans the amino acid sequence from region 22-184aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

IFN-beta; Ifnb1; Ifnb

UniProt

P70499

Expression Region

22-184aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Rattus norvegicus (Rat)

Field of Research

Infectious Disease & Virology; Immunology & Inflammation

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

21.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

IDYKQLQFRQSTSIRTCQKLLRQLNGRLNLSYRTDFKIPMEVMHPSQMEKSYTAFAIQVMLQNVFLVFRSNFSSTGWNETIVESLLDELHQQTELLEIILKEKQEERLTWVTSTTTLGLKSYYWRVQRYLKDKKYNSYAWMVVRAEVFRNFSIILRLNRNFQN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fktn 3'UTR Luciferase Stable Cell Line
TU204671 1.0 mL

Fktn 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Mouse Monoclonal Galectin-3 Antibody (194801) [Alexa Fluor 750]
FAB11542S 0.1 mL

Mouse Monoclonal Galectin-3 Antibody (194801) [Alexa Fluor 750]

Sign In for Pricing
View Details
PMPCA 3'UTR Luciferase Stable Cell Line
TU018326 1.0 mL

PMPCA 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Anti-Mouse VSIG1 Polyclonal Antibody
PMK99701 100 μg

Anti-Mouse VSIG1 Polyclonal Antibody

Sign In for Pricing
View Details
Anti-HMGB1 Polyclonal Antibody 3
TMAB-07182-01 50 μL

Anti-HMGB1 Polyclonal Antibody 3

Sign In for Pricing
View Details
Anti-HMGB1 Polyclonal Antibody 3
TMAB-07182-02 100 µL

Anti-HMGB1 Polyclonal Antibody 3

Sign In for Pricing
View Details