Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Macaca fascicularis Interleukin-1 beta (IL1B)

This Recombinant Macaca fascicularis Interleukin-1 beta (IL1B) spans the amino acid sequence from region 117-268aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

IL-1 beta; IL1B

UniProt

P79182

Expression Region

117-268aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Macaca fascicularis (Crab-eating macaque)

Field of Research

Immunology & Inflammation

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

21.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

APVRSLHCTLRDAQLKSLVMSGPYELKALHLQGQDLEQQVVFSMSFVQGEESNDKIPVALGLKAKNLYLSCVLKDDKPTLQLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYISTSQAESMPVFLGGTRGGQDITDFTMQFVS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TNFSF11 (Tumor Necrosis Factor Ligand Superfamily, Member 11, ODF, OPGL, sOdf, CD254, OPTB2, RANKL, TRANCE, hRANKL2) (AP)
MBS6441038-01 0.1 mL

TNFSF11 (Tumor Necrosis Factor Ligand Superfamily, Member 11, ODF, OPGL, sOdf, CD254, OPTB2, RANKL, TRANCE, hRANKL2) (AP)

Sign In for Pricing
View Details
TNFSF11 (Tumor Necrosis Factor Ligand Superfamily, Member 11, ODF, OPGL, sOdf, CD254, OPTB2, RANKL, TRANCE, hRANKL2) (AP)
MBS6441038-02 5x 0.1 mL

TNFSF11 (Tumor Necrosis Factor Ligand Superfamily, Member 11, ODF, OPGL, sOdf, CD254, OPTB2, RANKL, TRANCE, hRANKL2) (AP)

Sign In for Pricing
View Details
JAK3 (Janus Kinase 3, EC 2.7.10.2, JAKL, Leukocyte Janus Kinase, LJAK)
J0902-04A 100 µg

JAK3 (Janus Kinase 3, EC 2.7.10.2, JAKL, Leukocyte Janus Kinase, LJAK)

Sign In for Pricing
View Details
KATNB1 antibody
MBS833511-01 0.1 mL

KATNB1 antibody

Sign In for Pricing
View Details
KATNB1 antibody
MBS833511-02 5x 0.1 mL

KATNB1 antibody

Sign In for Pricing
View Details
Recombinant Coxiella burnetii Dihydrodipicolinate reductase (dapB)
MBS1030985-01 0.02 mg (E-Coli)

Recombinant Coxiella burnetii Dihydrodipicolinate reductase (dapB)

Sign In for Pricing
View Details