Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Growth hormone-releasing hormone receptor (GHRHR), partial

This Recombinant Human Growth hormone-releasing hormone receptor (GHRHR), partial spans the amino acid sequence from region 23-130. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Growth hormone-releasing factor receptor

UniProt

Q02643

Expression Region

23-127aa

Tag

N-terminal 10xHis-GST-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Metabolism Research

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

46.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

HMHPECDFITQLREDESACLQAAEEMPNTTLGCPATWDGLLCWPTAGSGEWVTLPCPDFFSHFSSESGAVKRDCTITGWSEPFPPYPVACPVPLELLAEEESYFS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CEP164 Antibody
E99964 100 µL

CEP164 Antibody

Sign In for Pricing
View Details
Chicken Matrix Metalloproteinase 1 (MMP1) ELISA Kit
abx355530 96 Well

Chicken Matrix Metalloproteinase 1 (MMP1) ELISA Kit

Sign In for Pricing
View Details
SLC25A40 Lentiviral Activation Particles (h)
sc-412644-LAC 200 µL

SLC25A40 Lentiviral Activation Particles (h)

Sign In for Pricing
View Details
AGL (NM_000645) Human Tagged ORF Clone Lentiviral Particle
RC214961L3V 200 µL

AGL (NM_000645) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Gibberellic Acid-13C,d2 (90%)
TRC-G377453-5MG 5 mg

Gibberellic Acid-13C,d2 (90%)

Sign In for Pricing
View Details
Recombinant Mycobacterium Ulcerans sepF Protein (aa 1-223)
VAng-Yyj3850-500gEcoli 500 µg (E. coli)

Recombinant Mycobacterium Ulcerans sepF Protein (aa 1-223)

Sign In for Pricing
View Details