Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Non-selective voltage-gated ion channel VDAC2 (Vdac2), partial

This Recombinant Mouse Non-selective voltage-gated ion channel VDAC2 (Vdac2), partial spans the amino acid sequence from region 1-37aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Outer mitochondrial membrane protein porin 2; Voltage-dependent anion-selective channel protein 6

UniProt

Q60930

Expression Region

1-37aa

Tag

N-terminal 6xHis-sumostar-tagged

Source

Yeast

Origin

Mus musculus (Mouse)

Field of Research

Neuroscience

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

17.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MAECCVPVCPRPMCIPPPYADLGKAARDIFNKGFGFG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Islet-1 Recombinant Antibody, Cy5 Conjugated
bsm-62843R-Cy5-TR 20 µL

Islet-1 Recombinant Antibody, Cy5 Conjugated

Sign In for Pricing
View Details
Z-Gly-Pro-pNA (prolyl endopeptidase substrate)
orb3032946-01 100 mg

Z-Gly-Pro-pNA (prolyl endopeptidase substrate)

Sign In for Pricing
View Details
Z-Gly-Pro-pNA (prolyl endopeptidase substrate)
orb3032946-02 250 mg

Z-Gly-Pro-pNA (prolyl endopeptidase substrate)

Sign In for Pricing
View Details
Z-Gly-Pro-pNA (prolyl endopeptidase substrate)
orb3032946-03 1 g

Z-Gly-Pro-pNA (prolyl endopeptidase substrate)

Sign In for Pricing
View Details
Human HAUS augmin-like complex subunit 4, HAUS4 ELISA KIT
ELI-14189h 96 Tests

Human HAUS augmin-like complex subunit 4, HAUS4 ELISA KIT

Sign In for Pricing
View Details
GENLISA™ Human FK506 Binding Protein 12-rapamycin associated Protein 1 (FRAP1) ELISA
KBH5104 1x 96 Well

GENLISA™ Human FK506 Binding Protein 12-rapamycin associated Protein 1 (FRAP1) ELISA

Sign In for Pricing
View Details