Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Non-selective voltage-gated ion channel VDAC2 (Vdac2), partial

This Recombinant Mouse Non-selective voltage-gated ion channel VDAC2 (Vdac2), partial spans the amino acid sequence from region 1-37aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Outer mitochondrial membrane protein porin 2; Voltage-dependent anion-selective channel protein 6

UniProt

Q60930

Expression Region

1-37aa

Tag

N-terminal 6xHis-sumostar-tagged

Source

Yeast

Origin

Mus musculus (Mouse)

Field of Research

Neuroscience

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

17.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MAECCVPVCPRPMCIPPPYADLGKAARDIFNKGFGFG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human LCOR (NM_032440) AAV Particle
RC224042A1V 250 µL

Human LCOR (NM_032440) AAV Particle

Sign In for Pricing
View Details
GTF2IRD1 (FITC)
564457-01 50 µg

GTF2IRD1 (FITC)

Sign In for Pricing
View Details
GTF2IRD1 (FITC)
564457-02 100 µg

GTF2IRD1 (FITC)

Sign In for Pricing
View Details
Recombinant Human GABARAP Protein, His Tag & Fc Tag
KMH1128-01 100 µg

Recombinant Human GABARAP Protein, His Tag & Fc Tag

Sign In for Pricing
View Details
Recombinant Human GABARAP Protein, His Tag & Fc Tag
KMH1128-02 50 µg

Recombinant Human GABARAP Protein, His Tag & Fc Tag

Sign In for Pricing
View Details
Recombinant Human HSP90 Protein
NBC1-18362 0.1 mg

Recombinant Human HSP90 Protein

Sign In for Pricing
View Details