Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Non-selective voltage-gated ion channel VDAC2 (Vdac2), partial

This Recombinant Mouse Non-selective voltage-gated ion channel VDAC2 (Vdac2), partial spans the amino acid sequence from region 1-37aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Outer mitochondrial membrane protein porin 2; Voltage-dependent anion-selective channel protein 6

UniProt

Q60930

Expression Region

1-37aa

Tag

N-terminal 6xHis-sumostar-tagged

Source

Yeast

Origin

Mus musculus (Mouse)

Field of Research

Neuroscience

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

17.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MAECCVPVCPRPMCIPPPYADLGKAARDIFNKGFGFG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RNF128 Polyclonal Antibody, AbBy Fluor™ 594 Conjugated
bs-9251R-BF594-01 20 µL

RNF128 Polyclonal Antibody, AbBy Fluor™ 594 Conjugated

Sign In for Pricing
View Details
RNF128 Polyclonal Antibody, AbBy Fluor™ 594 Conjugated
bs-9251R-BF594-02 100 µL

RNF128 Polyclonal Antibody, AbBy Fluor™ 594 Conjugated

Sign In for Pricing
View Details
TNFSF13 Rabbit Polyclonal Antibody
orb513022 100 µg

TNFSF13 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
DMGDH Antibody, Biotin conjugated
A69890-50UG 50 µg

DMGDH Antibody, Biotin conjugated

Sign In for Pricing
View Details
p95 NBS1 (NBN) Mouse Monoclonal Antibody [Clone ID: OTI3G3]
TA801423 100 µL

p95 NBS1 (NBN) Mouse Monoclonal Antibody [Clone ID: OTI3G3]

Sign In for Pricing
View Details
ELISA Kit For 45 kDa calcium-binding protein
E16114h 96 Tests

ELISA Kit For 45 kDa calcium-binding protein

Sign In for Pricing
View Details