Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Serine protease inhibitor Kazal-type 6 (SPINK6)

This Recombinant Human Serine protease inhibitor Kazal-type 6 (SPINK6) spans the amino acid sequence from region 24-80aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Kallikrein inhibitor

UniProt

Q6UWN8

Expression Region

24-80aa

Tag

N-terminal 10xHis-GST-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Pharmacology & Drug Discovery

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

41.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

QGGQVDCGEFQDPKVYCTRESNPHCGSDGQTYGNKCAFCKAIVKSGGKISLKHPGKC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MEN1 Antibody
E034285 100 µg -100 µL

MEN1 Antibody

Sign In for Pricing
View Details
Rabbit Polyclonal RBKS Antibody [Alexa Fluor 532]
NBP2-97078AF532 0.1 mL

Rabbit Polyclonal RBKS Antibody [Alexa Fluor 532]

Sign In for Pricing
View Details
Rgs18 Rabbit Polyclonal Antibody (Biotin)
orb2121580 100 µL

Rgs18 Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details
Human IgG1 Isotype Control Antibody (13R4)
FHJ92850 100 μg

Human IgG1 Isotype Control Antibody (13R4)

Sign In for Pricing
View Details
Linker for activation of T cells family, member 2
322451 100 µL

Linker for activation of T cells family, member 2

Sign In for Pricing
View Details
HoxA6 Lentiviral Activation Particles (h2)
sc-410823-LAC-2 200 µL

HoxA6 Lentiviral Activation Particles (h2)

Sign In for Pricing
View Details