Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Arachis hypogaea Ara h 8 allergen

This Recombinant Arachis hypogaea Ara h 8 allergen spans the amino acid sequence from region 1-157aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

UniProt

Q6VT83

Expression Region

1-157aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Arachis hypogaea (Peanut)

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

23 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MGVFTFEDEITSTVPPAKLYNAMKDADSITPKIIDDVKSVEIVEGNGGPGTIKKLTIVEDGETKFILHKVESIDEANYAYNYSVVGGVALPPTAEKITFETKLVEGPNGGSIGKLTLKYHTKGDAKPDEEELKKGKAKGEGLFRAIEGYVLANPTQY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FLAD1, CT (FLAD1, FAD synthase, FAD pyrophosphorylase, FMN adenylyltransferase, Flavin adenine dinucleotide synthase, Molybdenum cofactor biosynthesis protein-like region, FAD synthase region) (FITC) discontinued
035670-FITC 200 µL

FLAD1, CT (FLAD1, FAD synthase, FAD pyrophosphorylase, FMN adenylyltransferase, Flavin adenine dinucleotide synthase, Molybdenum cofactor biosynthesis protein-like region, FAD synthase region) (FITC) discontinued

Sign In for Pricing
View Details
(6-chloro-2-fluoro-3-methylphenyl) (cyclopropyl) methanol
PC1020451-01 250 mg

(6-chloro-2-fluoro-3-methylphenyl) (cyclopropyl) methanol

Sign In for Pricing
View Details
(6-chloro-2-fluoro-3-methylphenyl) (cyclopropyl) methanol
PC1020451-02 500 mg

(6-chloro-2-fluoro-3-methylphenyl) (cyclopropyl) methanol

Sign In for Pricing
View Details
(6-chloro-2-fluoro-3-methylphenyl) (cyclopropyl) methanol
PC1020451-03 1 g

(6-chloro-2-fluoro-3-methylphenyl) (cyclopropyl) methanol

Sign In for Pricing
View Details
Recombinant Human RSPO2 (C-Flag)
PHH2456-01 10 µg

Recombinant Human RSPO2 (C-Flag)

Sign In for Pricing
View Details
Recombinant Human RSPO2 (C-Flag)
PHH2456-02 50 µg

Recombinant Human RSPO2 (C-Flag)

Sign In for Pricing
View Details