Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Myocilin (MYOC), partial

This Recombinant Human Myocilin (MYOC), partial spans the amino acid sequence from region 241-504aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Myocilin 55 kDa subunit; Trabecular meshwork-induced glucocorticoid response protein

UniProt

Q99972

Expression Region

241-504aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

31.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GDTGCGELVWVGEPLTLRTAETITGKYGVWMRDPKPTYPYTQETTWRIDTVGTDVRQVFEYDLISQFMQGYPSKVHILPRPLESTGAVVYSGSLYFQGAESRTVIRYELNTETVKAEKEIPGAGYHGQFPYSWGGYTDIDLAVDEAGLWVIYSTDEAKGAIVLSKLNPENLELEQTWETNIRKQSVANAFIICGTLYTVSSYTSADATVNFAYDTGTGISKTLTIPFKNRYKYSSMIDYNPLEKKLFAWDNLNMVTYDIKLSKM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Rhesus Macaque FBXO7 Protein, His (Fc)-Avi-tagged
FBXO7-1491R 50 µg

Recombinant Rhesus Macaque FBXO7 Protein, His (Fc)-Avi-tagged

Sign In for Pricing
View Details
CTLA4 CHO-K1 Cell Line
ABC-X0518F 1 Vial

CTLA4 CHO-K1 Cell Line

Sign In for Pricing
View Details
Dynamin 1 antibody
70R-49666 100 µL

Dynamin 1 antibody

Sign In for Pricing
View Details
Gastrokine 1 (GKN1) Protein
abx263305-01 2 µg

Gastrokine 1 (GKN1) Protein

Sign In for Pricing
View Details
Gastrokine 1 (GKN1) Protein
abx263305-02 10 µg

Gastrokine 1 (GKN1) Protein

Sign In for Pricing
View Details
Gastrokine 1 (GKN1) Protein
abx263305-03 100 µg

Gastrokine 1 (GKN1) Protein

Sign In for Pricing
View Details