Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Myocilin (MYOC), partial

This Recombinant Human Myocilin (MYOC), partial spans the amino acid sequence from region 241-504aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Myocilin 55 kDa subunit; Trabecular meshwork-induced glucocorticoid response protein

UniProt

Q99972

Expression Region

241-504aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

31.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GDTGCGELVWVGEPLTLRTAETITGKYGVWMRDPKPTYPYTQETTWRIDTVGTDVRQVFEYDLISQFMQGYPSKVHILPRPLESTGAVVYSGSLYFQGAESRTVIRYELNTETVKAEKEIPGAGYHGQFPYSWGGYTDIDLAVDEAGLWVIYSTDEAKGAIVLSKLNPENLELEQTWETNIRKQSVANAFIICGTLYTVSSYTSADATVNFAYDTGTGISKTLTIPFKNRYKYSSMIDYNPLEKKLFAWDNLNMVTYDIKLSKM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human ITPKA Protein, N-His
bs-103584P-01 20 µg

Recombinant Human ITPKA Protein, N-His

Sign In for Pricing
View Details
Recombinant Human ITPKA Protein, N-His
bs-103584P-02 50 µg

Recombinant Human ITPKA Protein, N-His

Sign In for Pricing
View Details
GLYCTK Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a)
LV710456 1.0 µg DNA

GLYCTK Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a)

Sign In for Pricing
View Details
STAMBP Antibody
OAAL00535-100UG 100 µg

STAMBP Antibody

Sign In for Pricing
View Details
Mouse CD63 HEK293 Overexpression Lysate
MBS8116690-01 0.3 mg

Mouse CD63 HEK293 Overexpression Lysate

Sign In for Pricing
View Details
Mouse CD63 HEK293 Overexpression Lysate
MBS8116690-02 5x 0.3 mg

Mouse CD63 HEK293 Overexpression Lysate

Sign In for Pricing
View Details