Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Hephaestin (HEPH), partial

This Recombinant Human Hephaestin (HEPH), partial spans the amino acid sequence from region 300-580aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

HEPH ; KIAA0698

UniProt

Q9BQS7

Expression Region

300-580aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Metabolism Research

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

38.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

EIDVHTAFFHGQMLTTRGHHTDVANIFPATFVTAEMVPWEPGTWLISCQVNSHFRDGMQALYKVKSCSMAPPVDLLTGKVRQYFIEAHEIQWDYGPMGHDGSTGKNLREPGSISDKFFQKSSSRIGGTYWKVRYEAFQDETFQEKMHLEEDRHLGILGPVIRAEVGDTIQVVFYNRASQPFSMQPHGVFYEKDYEGTVYNDGSSYPGLVAKPFEKVTYRWTVPPHAGPTAQDPACLTWMYFSAADPIRDTNSGLVGPLLVCRAGALGADGKQKGVDKEFFL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Dansyl-L-leucine Cyclohexylammonium Salt
445772-01 100 mg

Dansyl-L-leucine Cyclohexylammonium Salt

Sign In for Pricing
View Details
Dansyl-L-leucine Cyclohexylammonium Salt
445772-02 250 mg

Dansyl-L-leucine Cyclohexylammonium Salt

Sign In for Pricing
View Details
Lenalidomide sodium
T81942-01 5 mg

Lenalidomide sodium

Sign In for Pricing
View Details
Lenalidomide sodium
T81942-02 50 mg

Lenalidomide sodium

Sign In for Pricing
View Details
Anti-HADHB Antibody Picoband®, APC Conjugate
A04776-2-APC 100 µg/Vial

Anti-HADHB Antibody Picoband®, APC Conjugate

Sign In for Pricing
View Details
TRADD Antibody
MBS9504771-01 0.05 mL

TRADD Antibody

Sign In for Pricing
View Details