Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Complement C1q tumor necrosis factor-related protein 6 (C1QTNF6), partial

This Recombinant Human Complement C1q tumor necrosis factor-related protein 6 (C1QTNF6), partial spans the amino acid sequence from region 47-278aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

C1QTNF6; CTRP6; UNQ581/PRO1151

UniProt

Q9BXI9

Expression Region

47-278aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cancer Biology; Immunology & Inflammation

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

53.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

TFDRAVASGCQRCCDSEDPLDPAHVSSASSSGRPHALPEIRPYINITILKGDKGDPGPMGLPGYMGREGPQGEPGPQGSKGDKGEMGSPGAPCQKRFFAFSVGRKTALHSGEDFQTLLFERVFVNLDGCFDMATGQFAAPLRGIYFFSLNVHSWNYKETYVHIMHNQKEAVILYAQPSERSIMQSQSVMLDLAYGDRVWVRLFKRQRENAIYSNDFDTYITFSGHLIKAEDD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MLC1SA (MYL6B) Mouse Monoclonal Antibody [Clone ID: OTI5B11]
CF811276 100 µg

MLC1SA (MYL6B) Mouse Monoclonal Antibody [Clone ID: OTI5B11]

Sign In for Pricing
View Details
TXNRD1 Recombinant Rabbit Monoclonal Antibody [JA11-32]
ET1704-81 100 µL

TXNRD1 Recombinant Rabbit Monoclonal Antibody [JA11-32]

Sign In for Pricing
View Details
DKK1 (N-term) Rabbit Polyclonal Antibody
AP51269PU-N 400 µL

DKK1 (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Zeaxanthin Dipalmitate
TRC-Z275005-100MG 100 mg

Zeaxanthin Dipalmitate

Sign In for Pricing
View Details
Caspase-7 Recombinant Rabbit monoclonal Antibody
HA751482 100 µL

Caspase-7 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
TF2H1 Antibody
8C10539-AAT 50 µg

TF2H1 Antibody

Sign In for Pricing
View Details