Recombinant Human CD58 protein (CD58), partial, Biotinylated (Active)
This Recombinant Human CD58 protein (CD58), partial (Active) spans the amino acid sequence from region 29-215aa. Purity: Greater than 95% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
CD58 protein; CD58
UniProt
Q9BRW0
Expression Region
29-215aa
Tag
C-terminal hFc1-avi-tagged
Source
Mammalian cell
Origin
Homo sapiens (Human)
Field of Research
Immunology & Inflammation
Endotoxin
Less than 1.0 EU/μg as determined by LAL method.
Purity
Greater than 95% as determined by SDS-PAGE.
Bioactivity
Measured by its binding ability in a functional ELISA. Immobilized Human CD2 at 5 μg/mL can bind Human CD58. The EC50 is 337.0-430.1 ng/mL.
Form
Lyophilized powder
Molecular Weight
49.9 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Preservative
Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4
AA Sequence
FSQQIYGVVYGNVTFHVPSNVPLKEVLWKKQKDKVAELENSEFRAFSSFKNRVYLDTVSGSLTIYNLTSSDEDEYEMESPNITDTMKFFLYVLESLPSPTLTCALTNGSIEVQCMIPEYYNSHRGLIMYSWDCPMEQCKRNSTSIYFKMENDLPQKIQCTLSNPLFNTTSSIILTTCIPSSGHSRHR
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
GTR15260357 1 Vial
Lentiviral mouse Lmx1b shRNA (UAS) - Lentiviral mouse Lmx1b shRNA (UAS) (25)
Sign In for Pricing
View Details ![Cy3 Conjugated Affinity Purified anti-Mouse IgG [H&L] [Goat]](https://cdn.genprice.uk/genprice/uk/genprice5.webp)
SC023 250 µg
Cy3 Conjugated Affinity Purified anti-Mouse IgG [H&L] [Goat]
Sign In for Pricing
View Details 