Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Interleukin-2 receptor subunit alpha (Il2ra), partial (Active)

This Recombinant Mouse Interleukin-2 receptor subunit alpha (Il2ra), partial (Active) spans the amino acid sequence from region 22-236aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Interleukin-2 receptor subunit alpha; IL-2 receptor subunit alpha; IL-2-RA; IL-2R subunit alpha; IL2-RA; p55; CD25; Il2ra; Il2r

UniProt

P01590

Expression Region

22-236aa

Tag

C-terminal 10xHis-tagged

Source

Mammalian cell

Origin

Mus musculus (Mouse)

Field of Research

Immunology & Inflammation

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

Greater than 95% as determined by SDS-PAGE.

Bioactivity

Measured by its binding ability in a functional ELISA. Immobilized Mouse Il2ra at 2 μg/mL can bind Mouse Il2. The EC50 is 95.00-116.2 ng/mL.

Form

Lyophilized powder

Molecular Weight

26.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4

AA Sequence

ELCLYDPPEVPNATFKALSYKNGTILNCECKRGFRRLKELVYMRCLGNSWSSNCQCTSNSHDKSRKQVTAQLEHQKEQQTTTDMQKPTQSMHQENLTGHCREPPPWKHEDSKRIYHFVEGQSVHYECIPGYKALQRGPAISICKMKCGKTGWTQPQLTCVDEREHHRFLASEESQGSRNSSPESETSCPITTTDFPQPTETTAMTETFVLTMEYK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit anti-Caenorhabditis elegans cyn-5 Polyclonal Antibody
MBS7159861 Inquire

Rabbit anti-Caenorhabditis elegans cyn-5 Polyclonal Antibody

Sign In for Pricing
View Details
Rat Myosin VIIA (MYO7A) ELISA Kit
MBS9923048-01 48 Well

Rat Myosin VIIA (MYO7A) ELISA Kit

Sign In for Pricing
View Details
Rat Myosin VIIA (MYO7A) ELISA Kit
MBS9923048-02 96 Well

Rat Myosin VIIA (MYO7A) ELISA Kit

Sign In for Pricing
View Details
Rat Myosin VIIA (MYO7A) ELISA Kit
MBS9923048-03 5x 96 Well

Rat Myosin VIIA (MYO7A) ELISA Kit

Sign In for Pricing
View Details
Rat Myosin VIIA (MYO7A) ELISA Kit
MBS9923048-04 10x 96 Well

Rat Myosin VIIA (MYO7A) ELISA Kit

Sign In for Pricing
View Details
Krt17 sgRNA CRISPR Lentivector set (Rat)
K6697801 3x 1.0 µg

Krt17 sgRNA CRISPR Lentivector set (Rat)

Sign In for Pricing
View Details