Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Macaca fascicularis Inositol 1,4,5-trisphosphate receptor-interacting protein-like 1 (ITPRIPL1), partial (Active)

This Recombinant Macaca fascicularis Inositol 1,4,5-trisphosphate receptor-interacting protein-like 1 (ITPRIPL1), partial (Active) spans the amino acid sequence from region 25-103aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Expression Region

25-103aa

Tag

C-terminal 10xHis-tagged

Source

Mammalian cell

Origin

Macaca fascicularis

Field of Research

Pharmacology & Drug Discovery

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

Greater than 95% as determined by SDS-PAGE.

Bioactivity

Measured by its binding ability in a functional ELISA. Immobilized Macaca fascicularis ITPRIPL1 at 2 μg/mL can bind Anti-ITPRIPL1 recombinant antibody. The EC50 is 3.759-4.428 ng/mL.

Form

Lyophilized powder

Molecular Weight

10.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4

AA Sequence

HPLMVSDRMDLDTLARSRQLEKRMSEEMRLLEMEFEERKQAAEQKQKAENFWRGDTSSDQLVLGKKDMGWPFQADGQEG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD3e (B-B12), CF405S conjugate, 0.1mg/mL
BNC041052-500 1x 500 µL

CD3e (B-B12), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD35 / CR1 (E11), CF640R conjugate, 0.1mg/mL
BNC400040-100 1x 100 µL

CD35 / CR1 (E11), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ACTH (Adrenocorticotrophic Hormone) (AH26), CF647 conjugate, 0.1mg/mL
BNC470026-500 1x 500 µL

ACTH (Adrenocorticotrophic Hormone) (AH26), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human IgG Immunoglobulin (IG266), CF594 conjugate, 0.1mg/mL
BNC940266-500 1x 500 µL

Human IgG Immunoglobulin (IG266), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD16 (C16/1045), CF594 conjugate, 0.1mg/mL
BNC941045-100 1x 100 µL

CD16 (C16/1045), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Eosinophil Peroxidase (AHE-1), CF647 conjugate, 0.1mg/mL
BNC471231-500 1x 500 µL

Eosinophil Peroxidase (AHE-1), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details