Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Macaca fascicularis Tissue factor (F3), partial (Active)

This Recombinant Macaca fascicularis Tissue factor (F3), partial (Active) spans the amino acid sequence from region 33-252aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Tissue factor; Coagulation factor III; F3

UniProt

A0A2K5VX02

Expression Region

33-252aa

Tag

C-terminal 10xHis-tagged

Source

Mammalian cell

Origin

Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

Greater than 95% as determined by SDS-PAGE.

Bioactivity

Measured by its binding ability in a functional ELISA. Immobilized Macaca fascicularis F3 at 2 μg/mL can bind Anti-F3 recombinant antibody. The EC50 is 0.4495-0.5538 ng/mL.

Form

Lyophilized powder

Molecular Weight

26.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4

AA Sequence

SGTTNTVAAYNLTWKSTNFKTILEWEPKPINQVYTVQISTKSGDWKSKCFYTADTECDLTDEIVKDVKQTYLARVFSYPAGHVESTGSTEEPPYENSPEFTPYLETNLGQPTIQSFEQVGTKVNVTVQDEWTLVRRNDTFLSLRDVFGKDLIYTLYYWKSSSSGKKTAKTNTNEFLIDVDKGENYCFSVQAVIPSRRTANRKSTDSPVECMGHEKGESRE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Standard rotor cover for
1217185 1 Unit

Standard rotor cover for

Sign In for Pricing
View Details
WbbD Antibody
orb835736 2 mg

WbbD Antibody

Sign In for Pricing
View Details
Rabbit AP 2 complex subunit β (AP2B1) ELISA kit
GTR10408938 96 Well

Rabbit AP 2 complex subunit β (AP2B1) ELISA kit

Sign In for Pricing
View Details
Lentiviral mouse Ppp1r21 shRNA (UAS) - Lentiviral mouse Ppp1r21 shRNA (UAS, RFP) (25)
GTR15269099 1 Vial

Lentiviral mouse Ppp1r21 shRNA (UAS) - Lentiviral mouse Ppp1r21 shRNA (UAS, RFP) (25)

Sign In for Pricing
View Details
Rabbit Monoclonal CD63 Antibody (2585C) [Janelia Fluor 549]
FAB50481I 0.1 mL

Rabbit Monoclonal CD63 Antibody (2585C) [Janelia Fluor 549]

Sign In for Pricing
View Details
Recombinant Streptococcus agalactiae serotype III Biotin synthase (bioB)
MBS1313479-01 0.02 mg (E-Coli)

Recombinant Streptococcus agalactiae serotype III Biotin synthase (bioB)

Sign In for Pricing
View Details