Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Claudin-6 (Cldn6) -VLPs (Active)

This Recombinant Mouse Claudin-6 (Cldn6) -VLPs (Active) spans the amino acid sequence from region 1-219aa. Purity: Greater than 95% as determined by SEC-HPLC.

Product Specifications

Product Name Alternative

Claudin-6; Skullin; Cldn6

UniProt

Q9Z262

Expression Region

1-219aa

Tag

C-terminal 10xHis-tagged (This tag can be tested only under denaturing conditions)

Source

Mammalian cell

Origin

Mus musculus (Mouse)

Field of Research

Cancer Biology

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

Greater than 95% as determined by SEC-HPLC.

Bioactivity

1Measured by its binding ability in a functional ELISA. Immobilized Mouse cldn6 at 5 μg/mL can bind Anti-CLDN6/9 recombinant antibody. The EC50 is 4.027-6.270 ng/mL. The VLPs is negative control. 2Measured by its binding ability in a functional ELISA. Immobilized Mouse cldn6 at 5 μg/mL can bind Anti-CLDN6/9 recombinant antibody. The EC50 is 7.349-12.12 ng/mL. The VLPs is negative control.

Form

Lyophilized powder

Molecular Weight

24.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein indeionized sterile water to a concentration of 0.1-1.0 mg/mL.Aliquot for long-term storage at -80°C. Solubilize for 60 minutes at room temperature with occasional gentle mixing. Avoid vigorous shaking or vortexing.

Preservative

Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4.

AA Sequence

MASTGLQILGIVLTLLGWVNALVSCALPMWKVTAFIGNSIVVAQMVWEGLWMSCVVQSTGQMQCKVYDSLLALPQDLQAARALCVVTLLIVLLGLLVYLAGAKCTTCVEDRNSKSRLVLISGIIFVISGVLTLIPVCWTAHSIIQDFYNPLVADAQKRELGASLYLGWAASGLLLLGGGLLCCACSSGGTQGPRHYMACYSTSVPHSRGPSEYPTKNYV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SUN1 (NM_001130965) Human Over-expression Lysate
LC427327 20 µg

SUN1 (NM_001130965) Human Over-expression Lysate

Sign In for Pricing
View Details
Recombinant Human CFHR1 protein (His tag)
PDEH100817-01 20 µg

Recombinant Human CFHR1 protein (His tag)

Sign In for Pricing
View Details
Recombinant Human CFHR1 protein (His tag)
PDEH100817-02 100 µg

Recombinant Human CFHR1 protein (His tag)

Sign In for Pricing
View Details
Recombinant Human CFHR1 protein (His tag)
PDEH100817-03 500 µg

Recombinant Human CFHR1 protein (His tag)

Sign In for Pricing
View Details
Recombinant Human CFHR1 protein (His tag)
PDEH100817-04 1 mg

Recombinant Human CFHR1 protein (His tag)

Sign In for Pricing
View Details
Anti-DYKDDDDK Tag Antibody
KC-17397-01 50 μL

Anti-DYKDDDDK Tag Antibody

Sign In for Pricing
View Details