Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Macaca fascicularis Lymphotoxin beta receptor (LTBR), partial (Active)

This Recombinant Macaca fascicularis Lymphotoxin beta receptor (LTBR), partial (Active) spans the amino acid sequence from region 28-229aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Lymphotoxin beta receptor; LTBR

UniProt

A0A2K5VGQ6

Expression Region

28-229aa

Tag

C-terminal hFc1-tagged

Source

Mammalian cell

Origin

Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)

Field of Research

Cell Biology

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

Greater than 95% as determined by SDS-PAGE.

Bioactivity

Measured by its binding ability in a functional ELISA. Immobilized Cynomolgus LTBR at 2 μg/mL can bind Biotinylated human TNFSF14. The EC50 is 4.316-4.875 ng/mL.

Form

Lyophilized powder

Molecular Weight

51.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4

AA Sequence

SQPQVVRKGPVPPYGSENQTCRDQEKEYYEPRHRICCSRCPPGTYVSAKCSRSRDTVCATCAENSYNEHWNYLTICQLCRPCDPVMGLEEIAPCTSKRKTQCRCQPGMFCAAWALECTHCELLSDCPPGTEAELKDEVGKGNNHCVPCKAGHFQNTSSPSARCQPHTRCEDQGLVEAAPGTAQSDTTCRNPSESLPPEMSGT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Phospho-PI3KCA (Tyr317) Polyclonal Antibody, PE-Cy7 Conjugated
bs-5570R-PE-Cy7 100 µL

Phospho-PI3KCA (Tyr317) Polyclonal Antibody, PE-Cy7 Conjugated

Sign In for Pricing
View Details
1-[2- (morpholin-4-yl) ethyl]-1H-1,2,3-triazole-4-carboxylic acid
sc-333432 1 g

1-[2- (morpholin-4-yl) ethyl]-1H-1,2,3-triazole-4-carboxylic acid

Sign In for Pricing
View Details
DNase I Polyclonal Antibody, AbBy Fluor™ 350 Conjugated
bs-7651R-BF350-TR 20 µL

DNase I Polyclonal Antibody, AbBy Fluor™ 350 Conjugated

Sign In for Pricing
View Details
WDR5 Rabbit mAb
F1363-20uL 20 µL

WDR5 Rabbit mAb

Sign In for Pricing
View Details
Fam195a 3'UTR Luciferase Stable Cell Line
TU204337 1.0 mL

Fam195a 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
TLR6 Peptide
MBS151922-01 0.05 mg

TLR6 Peptide

Sign In for Pricing
View Details