Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Ephrin-A1 (EFNA1) (Active)

This Recombinant Human Ephrin-A1 (EFNA1) (Active) spans the amino acid sequence from region 19-182aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Ephrin-A1; EPH-related receptor tyrosine kinase ligand 1 (LERK-1) ; Immediate early response protein B61; Tumor necrosis factor alpha-induced protein 4 (TNF alpha-induced protein 4) ; Ephrin-A1, secreted form; EFNA1; EPLG1, LERK1, TNFAIP4

UniProt

P20827

Expression Region

19-182aa

Tag

C-terminal hFc1-tagged

Source

Mammalian cell

Origin

Homo sapiens (Human)

Field of Research

Cardiovascular Research

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

Greater than 90% as determined by SDS-PAGE.

Bioactivity

Measured by its binding ability in a functional ELISA. Immobilized Human EPHA2 at 2 μg/mL can bind Human EFNA1. The EC50 is 5.859-7.758 ng/mL.

Form

Lyophilized powder

Molecular Weight

48.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4

AA Sequence

DRHTVFWNSSNPKFRNEDYTIHVQLNDYVDIICPHYEDHSVADAAMEQYILYLVEHEEYQLCQPQSKDQVRWQCNRPSAKHGPEKLSEKFQRFTPFTLGKEFKEGHSYYYISKPIHQHEDRCLRLKVTVSGKITHSPQAHDNPQEKRLAADDPEVRVLHSIGHS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Alpha-PVP Hydrochloride
TRC-D291955-1MG 1 mg

Alpha-PVP Hydrochloride

Sign In for Pricing
View Details
DNMT3B (1-50) Rabbit Polyclonal Antibody
AP31351PU-N 50 µL

DNMT3B (1-50) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Biglycan Antibody
OC-592-01 50 μL

Biglycan Antibody

Sign In for Pricing
View Details
Biglycan Antibody
OC-592-02 100 µL

Biglycan Antibody

Sign In for Pricing
View Details
Biglycan Antibody
OC-592-03 1 mL

Biglycan Antibody

Sign In for Pricing
View Details
ERCC8 (Center) Rabbit Polyclonal Antibody
AP51450PU-N 400 µL

ERCC8 (Center) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details