Recombinant Human Ephrin-A1 (EFNA1) (Active)
This Recombinant Human Ephrin-A1 (EFNA1) (Active) spans the amino acid sequence from region 19-182aa. Purity: Greater than 90% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
Ephrin-A1; EPH-related receptor tyrosine kinase ligand 1 (LERK-1) ; Immediate early response protein B61; Tumor necrosis factor alpha-induced protein 4 (TNF alpha-induced protein 4) ; Ephrin-A1, secreted form; EFNA1; EPLG1, LERK1, TNFAIP4
UniProt
P20827
Expression Region
19-182aa
Tag
C-terminal hFc1-tagged
Source
Mammalian cell
Origin
Homo sapiens (Human)
Field of Research
Cardiovascular Research
Endotoxin
Less than 1.0 EU/μg as determined by LAL method.
Purity
Greater than 90% as determined by SDS-PAGE.
Bioactivity
Measured by its binding ability in a functional ELISA. Immobilized Human EPHA2 at 2 μg/mL can bind Human EFNA1. The EC50 is 5.859-7.758 ng/mL.
Form
Lyophilized powder
Molecular Weight
48.3 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Preservative
Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4
AA Sequence
DRHTVFWNSSNPKFRNEDYTIHVQLNDYVDIICPHYEDHSVADAAMEQYILYLVEHEEYQLCQPQSKDQVRWQCNRPSAKHGPEKLSEKFQRFTPFTLGKEFKEGHSYYYISKPIHQHEDRCLRLKVTVSGKITHSPQAHDNPQEKRLAADDPEVRVLHSIGHS
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC883608-100 1x 100 µL
Langerin / CD207 (Marker of Langerhans Cells) (rLGRN/1821), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
![xCT/SLC7A11 Recombinant Mouse monoclonal Antibody [A7C6-R]](https://cdn.genprice.uk/products/992/68dd1c8b061270361ea814d1/imageurl/ha601071-50ul.webp)
HA601071-50UL 50 µL
xCT/SLC7A11 Recombinant Mouse monoclonal Antibody [A7C6-R]
Sign In for Pricing
View Details 
